Lineage for d6hqpa_ (6hqp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2723142Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2723143Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2724019Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2724020Protein automated matches [190847] (99 species)
    not a true protein
  7. 2724052Species Amycolatopsis sp. [TaxId:385957] [354294] (24 PDB entries)
  8. 2724064Domain d6hqpa_: 6hqp A: [370134]
    automated match to d3nc5a_
    complexed with hem, jz3

Details for d6hqpa_

PDB Entry: 6hqp (more details), 1.62 Å

PDB Description: crystal structure of gcoa f169v bound to guaiacol
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d6hqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hqpa_ a.104.1.0 (A:) automated matches {Amycolatopsis sp. [TaxId: 385957]}
rpdlawldevtmtqlernpyevyerlraeaplafvpvlgsyvastaevcrevatspdfea
vitpaggrtfghpaiigvngdihadlrsmvepalqpaevdrwiddlvrpiarrylerfen
dghaelvaqycepvsvrslgdllglqevdsdklrewfaklnrsvtnaavdengefanpeg
faegdqakaeiravvdplidkwiehpddsaishwlhdgmppgqtrdreyiyptiyvyllg
amqepghgmastlvglfsrpeqleevvddptlipraiaeglrwtspiwsataristkpvt
iagvdlpagtpvmlsygsanhdtgkyeapsqydlhrpplphlafgagnhacagiyfanhv
mrialeelfeaipnlerdtregvefwgwgfrgptslhvtwev

SCOPe Domain Coordinates for d6hqpa_:

Click to download the PDB-style file with coordinates for d6hqpa_.
(The format of our PDB-style files is described here.)

Timeline for d6hqpa_: