SCOPe 2.08: Domain d6gz0a_: 6gz0 A:

Lineage for d6gz0a_ (6gz0 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [271371] (5 PDB entries)

8. Domain d6gz0a_: 6gz0 A: [370127]
   automated match to d2y84d_
   complexed with cl, so4

Details for d6gz0a_

PDB Entry: 6gz0, 1.52 Å

PDB Description: crystal structure of the leuo effector binding domain

PDB Compounds: (A:) HTH-type transcriptional regulator LeuO

SCOPe Domain Sequences for d6gz0a_:

Sequence, based on SEQRES records:

>d6gz0a_ c.94.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
rvfhlcvcspldsiltsqiynhieqiapnihvmfksslnqntehqlryqetefvisyedf
hrpeftsvplfkdemvlvasknhptikgpllkhdvyneqhaavsldrfasfsqpwydtvd
kqasiayqgmammsvlsvvsqthlvaiaprwlaeefaeslelqvlplplkqnsrtcylsw
heaagrdkghqwmeeqlvsickr

Sequence, based on observed residues (ATOM records):

>d6gz0a_ c.94.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
rvfhlcvcspldsiltsqiynhieqiapnihvmfksslnyqetefvisyedfhftsvplf
kdemvlvasknhptikgpllkhdvyneqhaavsldrfasfsqpwydtvdkqasiayqgma
mmsvlsvvsqthlvaiaprwlaeefaeslelqvlplplkqnsrtcylswheaagrdkghq
wmeeqlvsickr

Timeline for d6gz0a_:

• d6gz0a_ first appeared in SCOPe 2.07