SCOPe 2.06: Domain d1stfe_: 1stf E:

Lineage for d1stfe_ (1stf E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Papain [54005] (1 species)

7. Species Papaya (Carica papaya) [TaxId:3649] [54006] (23 PDB entries)

8. Domain d1stfe_: 1stf E: [37012]
   Other proteins in same PDB: d1stfi_

Details for d1stfe_

PDB Entry: 1stf, 2.37 Å

PDB Description: the refined 2.4 angstroms x-ray crystal structure of recombinant human stefin b in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction

PDB Compounds: (E:) papain

SCOPe Domain Sequences for d1stfe_:

Sequence; same for both SEQRES and ATOM records:

>d1stfe_ d.3.1.1 (E:) Papain {Papaya (Carica papaya) [TaxId: 3649]}
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

Timeline for d1stfe_:

• d1stfe_ first appeared (with stable ids) in SCOP 1.55
  
• d1stfe_ appears in SCOPe 2.05
  
• d1stfe_ appears in SCOPe 2.07
  
• d1stfe_ appears in the current release, SCOPe 2.08