Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (13 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [370009] (2 PDB entries) |
Domain d6gv3a1: 6gv3 A:4-158 [370115] Other proteins in same PDB: d6gv3a2 automated match to d4l83a_ |
PDB Entry: 6gv3 (more details), 1.2 Å
SCOPe Domain Sequences for d6gv3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gv3a1 d.20.1.1 (A:4-158) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} giargrlaeerkswrknhphgfvakpetgqdgtvnlmvwhctipgkagtdweggffpltm hfsedypskppkckfpqgffhpnvypsgtvclsilnedygwrpaitvkqilvgiqdlldt pnpadpaqtdgyhlfcqdpveykkrvklqskqypa
Timeline for d6gv3a1: