Lineage for d6gv3a1 (6gv3 A:4-158)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2939257Protein automated matches [190124] (13 species)
    not a true protein
  7. 2939394Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [370009] (2 PDB entries)
  8. 2939395Domain d6gv3a1: 6gv3 A:4-158 [370115]
    Other proteins in same PDB: d6gv3a2
    automated match to d4l83a_

Details for d6gv3a1

PDB Entry: 6gv3 (more details), 1.2 Å

PDB Description: structure of the e2 conjugating enzyme, sce1, from arabidopsis thaliana.
PDB Compounds: (A:) SUMO-conjugating enzyme SCE1

SCOPe Domain Sequences for d6gv3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gv3a1 d.20.1.1 (A:4-158) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
giargrlaeerkswrknhphgfvakpetgqdgtvnlmvwhctipgkagtdweggffpltm
hfsedypskppkckfpqgffhpnvypsgtvclsilnedygwrpaitvkqilvgiqdlldt
pnpadpaqtdgyhlfcqdpveykkrvklqskqypa

SCOPe Domain Coordinates for d6gv3a1:

Click to download the PDB-style file with coordinates for d6gv3a1.
(The format of our PDB-style files is described here.)

Timeline for d6gv3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gv3a2