Lineage for d6h9wa_ (6h9w A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375619Species Rotavirus a [TaxId:28875] [277665] (10 PDB entries)
  8. 3070032Domain d6h9wa_: 6h9w A: [370094]
    automated match to d5jdba_
    complexed with cit, ipa, so4

Details for d6h9wa_

PDB Entry: 6h9w (more details), 1.35 Å

PDB Description: unraveling the role of the secretor antigen in human rotavirus attachment to histo-blood group antigens
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d6h9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h9wa_ b.29.1.0 (A:) automated matches {Rotavirus a [TaxId: 28875]}
ldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynvfge
nkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetprat
tdssntanlngisitihsefyiiprsqeskcneyinngl

SCOPe Domain Coordinates for d6h9wa_:

Click to download the PDB-style file with coordinates for d6h9wa_.
(The format of our PDB-style files is described here.)

Timeline for d6h9wa_:

  • d6h9wa_ is new in SCOPe 2.07-stable