Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Rotavirus a [TaxId:28875] [277665] (11 PDB entries) |
Domain d6h9za1: 6h9z A:4-162 [370089] Other proteins in same PDB: d6h9za2 automated match to d5jdba_ complexed with dtt, so4 |
PDB Entry: 6h9z (more details), 1.51 Å
SCOPe Domain Sequences for d6h9za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h9za1 b.29.1.0 (A:4-162) automated matches {Rotavirus a [TaxId: 28875]} ldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynvfge nkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetprat tdssntanlngisitihsefyiiprsqeskcneyinngl
Timeline for d6h9za1: