Lineage for d6h9yb1 (6h9y B:228-386)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781109Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries)
  8. 2781112Domain d6h9yb1: 6h9y B:228-386 [370082]
    Other proteins in same PDB: d6h9ya2, d6h9yb2
    automated match to d5jdba_
    complexed with btb

Details for d6h9yb1

PDB Entry: 6h9y (more details), 1.31 Å

PDB Description: unraveling the role of the secretor antigen in human rotavirus attachment to histo-blood group antigens
PDB Compounds: (B:) Outer capsid protein VP4

SCOPe Domain Sequences for d6h9yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h9yb1 b.29.1.0 (B:228-386) automated matches {Human rotavirus a [TaxId: 10941]}
ldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynvfge
nkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetprat
tdssntanlngisitihsefyiiprsqeskcneyinngl

SCOPe Domain Coordinates for d6h9yb1:

Click to download the PDB-style file with coordinates for d6h9yb1.
(The format of our PDB-style files is described here.)

Timeline for d6h9yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h9yb2