SCOPe 2.08: Domain d1ppda_: 1ppd A:

Lineage for d1ppda_ (1ppd A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Papain [54005] (1 species)

7. Species Papaya (Carica papaya) [TaxId:3649] [54006] (23 PDB entries)

8. Domain d1ppda_: 1ppd A: [37008]
   complexed with bme

Details for d1ppda_

PDB Entry: 1ppd, 2 Å

PDB Description: restrained least-squares refinement of the sulfhydryl protease papain to 2.0 angstroms

PDB Compounds: (A:) 2-hydroxyethyl-thiopapain

SCOPe Domain Sequences for d1ppda_:

Sequence; same for both SEQRES and ATOM records:

>d1ppda_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]}
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

Timeline for d1ppda_:

• d1ppda_ first appeared (with stable ids) in SCOP 1.55, called d1ppd__
  
• d1ppda_ appears in SCOPe 2.07