Lineage for d6hf6b_ (6hf6 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. Protein Intracellular protease [52326] (3 species)
  7. Species Pyrococcus horikoshii [TaxId:70601] [370077] (1 PDB entry)
  8. Domain d6hf6b_: 6hf6 B: [370078]
    automated match to d1g2ia_
    complexed with 7mt, mli, tb

Details for d6hf6b_

PDB Entry: 6hf6 (more details), 2 Å

PDB Description: crystal structure of the protease 1 (e29a,e60a,e80a) from pyrococcus horikoshii co-crystallized with tb-xo4.
PDB Compounds: (B:) Deglycase PH1704

SCOPe Domain Sequences for d6hf6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hf6b_ c.23.16.2 (B:) Intracellular protease {Pyrococcus horikoshii [TaxId: 70601]}
mkvlfltanefedveliypyhrlkeeghavyiasfergtitgkhgysvkvdltfdkvnpa
efdalvlpggrapervrlnakavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

SCOPe Domain Coordinates for d6hf6b_ are not available.

Timeline for d6hf6b_:

Domains from other chains:
(mouse over for more information)
d6hf6a_, d6hf6c_