Lineage for d9pap__ (9pap -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily) Superfamily d.3.1: Cysteine proteinases [54001] (7 families) 
Family d.3.1.1: Papain-like [54002] (15 proteins) Protein Papain [54005] (1 species) Species Papaya (Carica papaya) [TaxId:3649] [54006] (16 PDB entries) 
Domain d9pap__: 9pap - [37006]
Details for d9pap__
PDB Entry: 9pap (more details), 1.65 Å
PDB Description: structure of papain refined at 1.65 angstroms resolution
SCOP Domain Sequences for d9pap__:
Sequence; same for both SEQRES and ATOM records: (download)
>d9pap__ d.3.1.1 (-) Papain {Papaya (Carica papaya)}
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn
SCOP Domain Coordinates for d9pap__:
Click to download the PDB-style file with coordinates for d9pap__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d9pap__:
- d9pap__ appears in SCOP 1.57
- d9pap__ appears in the current release, SCOPe 2.08, called d9papa_
View in 3D