SCOPe 2.08: Domain d6h9ya1: 6h9y A:228-386

Lineage for d6h9ya1 (6h9y A:228-386)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries)

8. Domain d6h9ya1: 6h9y A:228-386 [370036]
   Other proteins in same PDB: d6h9ya2, d6h9yb2
   automated match to d5jdba_
   complexed with btb

Details for d6h9ya1

PDB Entry: 6h9y, 1.31 Å

PDB Description: unraveling the role of the secretor antigen in human rotavirus attachment to histo-blood group antigens

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d6h9ya1:

Sequence; same for both SEQRES and ATOM records:

>d6h9ya1 b.29.1.0 (A:228-386) automated matches {Human rotavirus a [TaxId: 10941]}
ldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynvfge
nkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetprat
tdssntanlngisitihsefyiiprsqeskcneyinngl

Timeline for d6h9ya1:

• d6h9ya1 first appeared in SCOPe 2.07