Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Escherichia coli [TaxId:83333] [271371] (5 PDB entries) |
Domain d6gz1a1: 6gz1 A:112-314 [370023] Other proteins in same PDB: d6gz1a2 automated match to d2y84h_ complexed with so4 |
PDB Entry: 6gz1 (more details), 1.74 Å
SCOPe Domain Sequences for d6gz1a1:
Sequence, based on SEQRES records: (download)
>d6gz1a1 c.94.1.0 (A:112-314) automated matches {Escherichia coli [TaxId: 83333]} rvfhlcvcdpldsiltsqiynhieqiapnihvmfksslnqntehqlryqetefvisyedf hrpeftsvplfkdemvlvasknhptikgpllkhdvyneqhaavsldrfasfsqpwydtvd kqasiayqgmammsvlsvvsqthlvaiaprwlaeefaeslelqvlplplkqnsrtcylsw heaagrdkghqwmeeqlvsickr
>d6gz1a1 c.94.1.0 (A:112-314) automated matches {Escherichia coli [TaxId: 83333]} rvfhlcvcdpldsiltsqiynhieqiapnihvmfksslnqetefvisyedfhftsvplfk demvlvasknhptikgpllkhdvyneqhaavsldrfasfsqpwydtvdkqasiayqgmam msvlsvvsqthlvaiaprwlaeefaeslelqvlplplkqnsrtcylswheaagrdkghqw meeqlvsickr
Timeline for d6gz1a1: