Lineage for d6gz1a1 (6gz1 A:112-314)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915529Species Escherichia coli [TaxId:83333] [271371] (5 PDB entries)
  8. 2915534Domain d6gz1a1: 6gz1 A:112-314 [370023]
    Other proteins in same PDB: d6gz1a2
    automated match to d2y84h_
    complexed with so4

Details for d6gz1a1

PDB Entry: 6gz1 (more details), 1.74 Å

PDB Description: crystal structure of the leuo effector binding domain
PDB Compounds: (A:) HTH-type transcriptional regulator LeuO

SCOPe Domain Sequences for d6gz1a1:

Sequence, based on SEQRES records: (download)

>d6gz1a1 c.94.1.0 (A:112-314) automated matches {Escherichia coli [TaxId: 83333]}
rvfhlcvcdpldsiltsqiynhieqiapnihvmfksslnqntehqlryqetefvisyedf
hrpeftsvplfkdemvlvasknhptikgpllkhdvyneqhaavsldrfasfsqpwydtvd
kqasiayqgmammsvlsvvsqthlvaiaprwlaeefaeslelqvlplplkqnsrtcylsw
heaagrdkghqwmeeqlvsickr

Sequence, based on observed residues (ATOM records): (download)

>d6gz1a1 c.94.1.0 (A:112-314) automated matches {Escherichia coli [TaxId: 83333]}
rvfhlcvcdpldsiltsqiynhieqiapnihvmfksslnqetefvisyedfhftsvplfk
demvlvasknhptikgpllkhdvyneqhaavsldrfasfsqpwydtvdkqasiayqgmam
msvlsvvsqthlvaiaprwlaeefaeslelqvlplplkqnsrtcylswheaagrdkghqw
meeqlvsickr

SCOPe Domain Coordinates for d6gz1a1:

Click to download the PDB-style file with coordinates for d6gz1a1.
(The format of our PDB-style files is described here.)

Timeline for d6gz1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gz1a2