SCOPe 2.06: Domain d2acta_: 2act A:

Lineage for d2acta_ (2act A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Actinidin [54003] (1 species)

7. Species Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId:3625] [54004] (2 PDB entries)

8. Domain d2acta_: 2act A: [37002]
   complexed with nh4

Details for d2acta_

PDB Entry: 2act, 1.7 Å

PDB Description: crystallographic refinement of the structure of actinidin at 1.7 angstroms resolution by fast fourier least-squares methods

PDB Compounds: (A:) actinidain precursor

SCOPe Domain Sequences for d2acta_:

Sequence; same for both SEQRES and ATOM records:

>d2acta_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]}
lpsyvdwrsagavvdiksqgecggcwafsaiatveginkitsgslislseqelidcgrtq
ntrgcdggyitdgfqfiindgginteenypytaqdgdcdvalqdqkyvtidtyenvpynn
ewalqtavtyqpvsvaldaagdafkqyasgiftgpcgtavdhaivivgygteggvdywiv
knswdttwgeegymrilrnvggagtcgiatmpsypvky

Timeline for d2acta_:

• d2acta_ first appeared (with stable ids) in SCOP 1.55, called d2act__
  
• d2acta_ appears in SCOPe 2.05
  
• d2acta_ appears in SCOPe 2.07
  
• d2acta_ appears in the current release, SCOPe 2.08