Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins) Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801 Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811) |
Protein JMJD2A core [254342] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254775] (57 PDB entries) |
Domain d6h4va_: 6h4v A: [370019] automated match to d5f2sb_ complexed with cl, dms, fqn, zn |
PDB Entry: 6h4v (more details), 2.15 Å
SCOPe Domain Sequences for d6h4va_:
Sequence, based on SEQRES records: (download)
>d6h4va_ b.82.2.14 (A:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]} etlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddl vipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknl tfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsf awhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtli splmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavl cscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
>d6h4va_ b.82.2.14 (A:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]} etlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddl vipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknl tfnppiygadvngtlyekhvdewnigrlrtildlvegvntpylyfgmwktsfawhtedmd lysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplmlkky gipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscrkdmv kismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
Timeline for d6h4va_: