Lineage for d6gx2a1 (6gx2 A:64-354)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898744Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2898797Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 2898798Species Human (Homo sapiens) [TaxId:9606] [75277] (59 PDB entries)
    Uniprot P16442 64-345
  8. 2898799Domain d6gx2a1: 6gx2 A:64-354 [370011]
    Other proteins in same PDB: d6gx2a2
    automated match to d1lzia_
    complexed with edo, gol, mn, so4, udp

Details for d6gx2a1

PDB Entry: 6gx2 (more details), 1.07 Å

PDB Description: blood group synthase aaglyb in complex with udp-galnac and cryoprotected with glycerol
PDB Compounds: (A:) ABO blood group (Transferase A, alpha 1-3-N-acetylgalactosaminyltransferase transferase B, alpha 1-3-galactosyltransferase)

SCOPe Domain Sequences for d6gx2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gx2a1 c.68.1.9 (A:64-354) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp

SCOPe Domain Coordinates for d6gx2a1:

Click to download the PDB-style file with coordinates for d6gx2a1.
(The format of our PDB-style files is described here.)

Timeline for d6gx2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gx2a2