Lineage for d6gv2a_ (6gv2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835262Species Sulfolobus solfataricus [TaxId:2287] [195677] (7 PDB entries)
  8. 2835273Domain d6gv2a_: 6gv2 A: [370000]
    automated match to d1w3ia_
    complexed with edo, gol, gxv, ssh

Details for d6gv2a_

PDB Entry: 6gv2 (more details), 2.1 Å

PDB Description: sulfolobus solfataricus 2-keto-3-deoxygluconate aldolase y103f,y130f, a198f variant in complex with l-2-keto, 3-deoxy-galactonate
PDB Compounds: (A:) 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase

SCOPe Domain Sequences for d6gv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gv2a_ c.1.10.1 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyfyprmsekhlvkyfktlce
vsphpvylfnyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvafgsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

SCOPe Domain Coordinates for d6gv2a_:

Click to download the PDB-style file with coordinates for d6gv2a_.
(The format of our PDB-style files is described here.)

Timeline for d6gv2a_: