Lineage for d1chkb_ (1chk B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76909Family d.2.1.7: Chitosanase [53996] (1 protein)
  6. 76910Protein Endochitosanase [53997] (2 species)
  7. 76913Species Streptomyces sp., strain N174 [TaxId:1931] [53998] (1 PDB entry)
  8. 76915Domain d1chkb_: 1chk B: [37000]

Details for d1chkb_

PDB Entry: 1chk (more details), 2.4 Å

PDB Description: streptomyces n174 chitosanase ph5.5 298k

SCOP Domain Sequences for d1chkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chkb_ d.2.1.7 (B:) Endochitosanase {Streptomyces sp., strain N174}
agaglddphkkeiamelvssaenssldwkaqykyiedigdgrgytggiigfcsgtgdmle
lvqhytdlepgnilakylpalkkvngsashsglgtpftkdwataakdtvfqqaqnderdr
vyfdpavsqakadglralgqfayydaivmhgpgndptsfggirktamkkartpaqggdet
tylngfldarkaamlteaahddtsrvdteqrvflkagnldlnpplkwktygdpyvins

SCOP Domain Coordinates for d1chkb_:

Click to download the PDB-style file with coordinates for d1chkb_.
(The format of our PDB-style files is described here.)

Timeline for d1chkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1chka_