SCOPe 2.08: Domain d6gt8b_: 6gt8 B:

Lineage for d6gt8b_ (6gt8 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [195677] (7 PDB entries)

8. Domain d6gt8b_: 6gt8 B: [369988]
   automated match to d1w3ia_
   complexed with ssh

Details for d6gt8b_

PDB Entry: 6gt8, 3.15 Å

PDB Description: sulfolobus solfataricus 2-keto-3-deoxygluconate aldolase y132v,t157c variant

PDB Compounds: (B:) 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase

SCOPe Domain Sequences for d6gt8b_:

Sequence; same for both SEQRES and ATOM records:

>d6gt8b_ c.1.10.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynvptatgkdidakvakeigcftgvxdcieniihtldykrlnpnmlvysgsd
mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

Timeline for d6gt8b_:

• d6gt8b_ first appeared in SCOPe 2.07