Lineage for d1quta_ (1qut A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2154423Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 protein domains)
    the large N-terminal domain is all-alpha superhelix
  6. 2154424Protein 36 kDa soluble lytic transglycosylase, SLT35 [53994] (1 species)
  7. 2154425Species Escherichia coli [TaxId:562] [53995] (8 PDB entries)
  8. 2154433Domain d1quta_: 1qut A: [36998]
    complexed with na, nag

Details for d1quta_

PDB Entry: 1qut (more details), 2.44 Å

PDB Description: the soluble lytic transglycosylase slt35 from escherichia coli in complex with n-acetylglucosamine
PDB Compounds: (A:) lytic murein transglycosylase b

SCOPe Domain Sequences for d1quta_:

Sequence, based on SEQRES records: (download)

>d1quta_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]}
mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqa
pttsvkppsgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgii
gvetrwgrvmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfag
amgygqfmpssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqa
pglpngfktkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitryn
hsthyamavwqlgqavalarvq

Sequence, based on observed residues (ATOM records): (download)

>d1quta_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]}
mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqg
pngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigvetrwgrvm
gktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagamgygqfmps
sykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapglpngfktk
ysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhsthyamavw
qlgqavalarvq

SCOPe Domain Coordinates for d1quta_:

Click to download the PDB-style file with coordinates for d1quta_.
(The format of our PDB-style files is described here.)

Timeline for d1quta_: