Lineage for d1d0ma_ (1d0m A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 29543Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 proteins)
  6. 29544Protein 36 kDa soluble lytic transglycosylase, SLT35 [53994] (1 species)
  7. 29545Species Escherichia coli [TaxId:562] [53995] (8 PDB entries)
  8. 29552Domain d1d0ma_: 1d0m A: [36997]

Details for d1d0ma_

PDB Entry: 1d0m (more details), 2.47 Å

PDB Description: the escherichia coli lytic transglycosylase slt35 in complex with bulgecin a and (glcnac)2

SCOP Domain Sequences for d1d0ma_:

Sequence, based on SEQRES records: (download)

>d1d0ma_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli}
mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqa
pttsvkppsgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgii
gvetrwgrvmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfag
amgygqfmpssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqa
pglpngfktkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitryn
hsthyamavwqlgqavalarvq

Sequence, based on observed residues (ATOM records): (download)

>d1d0ma_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli}
mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqg
pngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigvetrwgrvm
gktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagamgygqfmps
sykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapglpngfktk
ysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhsthyamavw
qlgqavalarvq

SCOP Domain Coordinates for d1d0ma_:

Click to download the PDB-style file with coordinates for d1d0ma_.
(The format of our PDB-style files is described here.)

Timeline for d1d0ma_: