SCOPe 2.07: Domain d6gtia2: 6gti A:167-340

Lineage for d6gtia2 (6gti A:167-340)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (60 PDB entries)

8. Domain d6gtia2: 6gti A:167-340 [369963]
   Other proteins in same PDB: d6gtia1
   automated match to d2bw4a2
   complexed with cu, mli, no2

Details for d6gtia2

PDB Entry: 6gti, 1.5 Å

PDB Description: achromobacter cycloclastes copper nitrite reductase at ph 5.0

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6gtia2:

Sequence; same for both SEQRES and ATOM records:

>d6gtia2 b.6.1.3 (A:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

Timeline for d6gtia2:

• d6gtia2 is new in SCOPe 2.07-stable
  
• d6gtia2 appears in the current release, SCOPe 2.08