Lineage for d6gtia1 (6gti A:8-166)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. Protein automated matches [190824] (31 species)
    not a true protein
  7. Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries)
  8. Domain d6gtia1: 6gti A:8-166 [369962]
    Other proteins in same PDB: d6gtia2
    automated match to d5i6la1
    complexed with cu, mli, no2

Details for d6gtia1

PDB Entry: 6gti (more details), 1.5 Å

PDB Description: achromobacter cycloclastes copper nitrite reductase at ph 5.0
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6gtia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gtia1 b.6.1.0 (A:8-166) automated matches {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d6gtia1 are not available.

Timeline for d6gtia1:

Domains from same chain:
(mouse over for more information)
d6gtia2