Lineage for d6gkqa_ (6gkq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779191Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species)
  7. 2779192Species Human (Homo sapiens) [TaxId:9606] [49939] (5 PDB entries)
  8. 2779197Domain d6gkqa_: 6gkq A: [369958]
    automated match to d1lcla_
    complexed with gol

Details for d6gkqa_

PDB Entry: 6gkq (more details), 2.3 Å

PDB Description: x-ray structure determined from ex vivo charcot-leyden crystal
PDB Compounds: (A:) Galectin-10

SCOPe Domain Sequences for d6gkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gkqa_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens) [TaxId: 9606]}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvs

SCOPe Domain Coordinates for d6gkqa_:

Click to download the PDB-style file with coordinates for d6gkqa_.
(The format of our PDB-style files is described here.)

Timeline for d6gkqa_: