Lineage for d6gjuc1 (6gju C:6-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369702Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2369748Domain d6gjuc1: 6gju C:6-120 [369946]
    Other proteins in same PDB: d6gjub2, d6gjuc2
    automated match to d4nbzb_
    complexed with gol, peg

Details for d6gjuc1

PDB Entry: 6gju (more details), 2.6 Å

PDB Description: human nbd1 of cftr in complex with nanobodies t2a and t4
PDB Compounds: (C:) Nanobody T2a

SCOPe Domain Sequences for d6gjuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gjuc1 b.1.1.0 (C:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgsifridamgwyrqapgkqrelvahstsggstdyadsvkg
rftisrdnakntvylqmnslkpedtavyycnadvrtrwyasnnywgqgtqvtvss

SCOPe Domain Coordinates for d6gjuc1:

Click to download the PDB-style file with coordinates for d6gjuc1.
(The format of our PDB-style files is described here.)

Timeline for d6gjuc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gjuc2