Lineage for d6guqa_ (6guq A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. Protein automated matches [190646] (77 species)
    not a true protein
  7. Species Geobacillus stearothermophilus [TaxId:1422] [369939] (4 PDB entries)
  8. Domain d6guqa_: 6guq A: [369940]
    automated match to d1guda_
    complexed with bgc

Details for d6guqa_

PDB Entry: 6guq (more details), 2.3899999999999997 Å

PDB Description: crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
PDB Compounds: (A:) Putative sugar binding protein

SCOPe Domain Sequences for d6guqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6guqa_ c.93.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
ayhfvlvpeeldndywrlvekgakaaakelgvdleyigprqanidehlrilkkaaaakvd
giitqglteaefvpvineitdknipvvtidtdaptsrrvayvgtdnyyagflagralaed
tkgkatvaiitgsltaahqqlrvrgfedavrqekgirivaieeshitrvqaaekaytilk
khpdvnafygtsaldaigvakvveqfhreqktyiigfdtlpetirylqkgtiaatvvqep
yemgykavkmmaeivagkdvpvvtntetkvirkkdlpl

SCOPe Domain Coordinates for d6guqa_ are not available.

Timeline for d6guqa_: