Lineage for d1d0ka_ (1d0k A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 proteins)
    the large N-terminal domain is all-alpha superhelix
  6. Protein 36 kDa soluble lytic transglycosylase, SLT35 [53994] (1 species)
  7. Species Escherichia coli [TaxId:562] [53995] (8 PDB entries)
  8. Domain d1d0ka_: 1d0k A: [36994]
    complexed with ala, ca, dgl, gol

Details for d1d0ka_

PDB Entry: 1d0k (more details), 2.02 Å

PDB Description: the escherichia coli lytic transglycosylase slt35 in complex with two murodipeptides (glcnac-murnac-l-ala-d-glu)
PDB Compounds: (A:) 35kd soluble lytic transglycosylase

SCOPe Domain Sequences for d1d0ka_:

Sequence, based on SEQRES records: (download)

>d1d0ka_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]}
mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqa
pttsvkppsgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgii
gvetrwgrvmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfag
amgygqfmpssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqa
pglpngfktkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitryn
hsthyamavwqlgqavalarvq

Sequence, based on observed residues (ATOM records): (download)

>d1d0ka_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]}
mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqa
pgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigvetrwgr
vmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagamgygqfm
pssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapglpngfk
tkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhsthyama
vwqlgqavalarvq

SCOPe Domain Coordinates for d1d0ka_ are not available.

Timeline for d1d0ka_: