Lineage for d6gjqe_ (6gjq E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478252Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2478268Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2478269Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
    Uniprot P13569 389-671
  8. 2478303Domain d6gjqe_: 6gjq E: [369931]
    Other proteins in same PDB: d6gjqb1, d6gjqb2, d6gjqd1, d6gjqd2, d6gjqf1, d6gjqf2, d6gjqh1, d6gjqh2
    automated match to d2pzga_
    complexed with atp

Details for d6gjqe_

PDB Entry: 6gjq (more details), 2.49 Å

PDB Description: human nbd1 of cftr in complex with nanobody t27
PDB Compounds: (E:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d6gjqe_:

Sequence, based on SEQRES records: (download)

>d6gjqe_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
dinfkiergqllavagstgagktsllmmimgelepsegkikhsgrisfcpqfswimpgti
keniifgvsydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislarav
ykdadlylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililheg
ssyfygtfselqnlq

Sequence, based on observed residues (ATOM records): (download)

>d6gjqe_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
dinfkiergqllavagstgagktsllmmimgelepsrisfcpqfswimpgtikeniifgv
sydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykdadlyl
ldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfygtf
selqnlq

SCOPe Domain Coordinates for d6gjqe_:

Click to download the PDB-style file with coordinates for d6gjqe_.
(The format of our PDB-style files is described here.)

Timeline for d6gjqe_: