![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
![]() | Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries) Uniprot P13569 389-671 |
![]() | Domain d6gjqe_: 6gjq E: [369931] Other proteins in same PDB: d6gjqb1, d6gjqb2, d6gjqd1, d6gjqd2, d6gjqf1, d6gjqf2, d6gjqh1, d6gjqh2 automated match to d2pzga_ complexed with atp |
PDB Entry: 6gjq (more details), 2.49 Å
SCOPe Domain Sequences for d6gjqe_:
Sequence, based on SEQRES records: (download)
>d6gjqe_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]} dinfkiergqllavagstgagktsllmmimgelepsegkikhsgrisfcpqfswimpgti keniifgvsydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislarav ykdadlylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililheg ssyfygtfselqnlq
>d6gjqe_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]} dinfkiergqllavagstgagktsllmmimgelepsrisfcpqfswimpgtikeniifgv sydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykdadlyl ldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfygtf selqnlq
Timeline for d6gjqe_: