Lineage for d6gt6b1 (6gt6 B:16-244)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (33 species)
    not a true protein
  7. 2390333Species Human (Homo sapiens) [TaxId:9606] [187421] (92 PDB entries)
  8. 3069865Domain d6gt6b1: 6gt6 B:16-244 [369927]
    Other proteins in same PDB: d6gt6b2
    automated match to d1mzaa_
    complexed with cys, gol, man, nag, so4

Details for d6gt6b1

PDB Entry: 6gt6 (more details), 2.54 Å

PDB Description: crystal structure of recombinant coagulation factor beta-xiia
PDB Compounds: (B:) Coagulation factor XII

SCOPe Domain Sequences for d6gt6b1:

Sequence, based on SEQRES records: (download)

>d6gt6b1 b.47.1.0 (B:16-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvgglvalrgahpyiaalywghsfcagsliapcwvltaahclqdrpapedltvvlgqerr
nhscepcqtlavrsyrlheafspvsyqhdlallrlqedadgscallspyvqpvclpsgaa
rpsettlcqvagwghqfegaeeyasflqeaqvpflslercsapdvhgssilpgmlcagfl
eggtdacqgdsggplvcedqaaerrltlqgiiswgsgcgdrnkpgvytdvayylawireh
tvs

Sequence, based on observed residues (ATOM records): (download)

>d6gt6b1 b.47.1.0 (B:16-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvgglvalrgahpyiaalywghsfcagsliapcwvltaahclqdrpapedltvvlgqerr
nhscepcqtlavrsyrlheafspvsyqhdlallrlqedadgscallspyvqpvclpsgap
settlcqvagwghqfegaeeyasflqeaqvpflslercsapdvhgssilpgmlcagfleg
gtdacqgdsggplvcedrltlqgiiswgsgcgdrnkpgvytdvayylawirehtvs

SCOPe Domain Coordinates for d6gt6b1:

Click to download the PDB-style file with coordinates for d6gt6b1.
(The format of our PDB-style files is described here.)

Timeline for d6gt6b1:

  • d6gt6b1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6gt6b2