Lineage for d1ltma_ (1ltm A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2496981Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 protein domains)
    the large N-terminal domain is all-alpha superhelix
  6. 2496982Protein 36 kDa soluble lytic transglycosylase, SLT35 [53994] (1 species)
  7. 2496983Species Escherichia coli [TaxId:562] [53995] (8 PDB entries)
  8. 2496985Domain d1ltma_: 1ltm A: [36992]
    complexed with bcn, edo, na

Details for d1ltma_

PDB Entry: 1ltm (more details), 1.7 Å

PDB Description: accelerated x-ray structure elucidation of a 36 kda muramidase/transglycosylase using warp
PDB Compounds: (A:) 36 kda soluble lytic transglycosylase

SCOPe Domain Sequences for d1ltma_:

Sequence, based on SEQRES records: (download)

>d1ltma_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]}
epqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqapt
tsvkppsgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigv
etrwgrvmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagam
gygqfmpssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapg
lpngfktkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhs
thyamavwqlgqavalarvq

Sequence, based on observed residues (ATOM records): (download)

>d1ltma_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]}
epqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdngpng
awlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigvetrwgrvmgkt
rildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagamgygqfmpssyk
qyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapglpngfktkysi
sqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhsthyamavwqlg
qavalarvq

SCOPe Domain Coordinates for d1ltma_:

Click to download the PDB-style file with coordinates for d1ltma_.
(The format of our PDB-style files is described here.)

Timeline for d1ltma_: