Lineage for d6gkoa_ (6gko A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579226Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)
  8. 2579250Domain d6gkoa_: 6gko A: [369915]
    automated match to d4eb4a_
    complexed with dms, fgt, ump

Details for d6gkoa_

PDB Entry: 6gko (more details), 1.84 Å

PDB Description: mouse thymidylate synthase cocrystallized with dump and soaked in phenolphthalein
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d6gkoa_:

Sequence, based on SEQRES records: (download)

>d6gkoa_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav

Sequence, based on observed residues (ATOM records): (download)

>d6gkoa_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphptimemav

SCOPe Domain Coordinates for d6gkoa_:

Click to download the PDB-style file with coordinates for d6gkoa_.
(The format of our PDB-style files is described here.)

Timeline for d6gkoa_: