Lineage for d1qusa_ (1qus A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2154423Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 protein domains)
    the large N-terminal domain is all-alpha superhelix
  6. 2154424Protein 36 kDa soluble lytic transglycosylase, SLT35 [53994] (1 species)
  7. 2154425Species Escherichia coli [TaxId:562] [53995] (8 PDB entries)
  8. 2154426Domain d1qusa_: 1qus A: [36991]
    complexed with bcn, edo, na

Details for d1qusa_

PDB Entry: 1qus (more details), 1.7 Å

PDB Description: 1.7 a resolution structure of the soluble lytic transglycosylase slt35 from escherichia coli
PDB Compounds: (A:) lytic murein transglycosylase b

SCOPe Domain Sequences for d1qusa_:

Sequence, based on SEQRES records: (download)

>d1qusa_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]}
mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqa
pttsvkppsgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgii
gvetrwgrvmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfag
amgygqfmpssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqa
pglpngfktkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitryn
hsthyamavwqlgqavalarvq

Sequence, based on observed residues (ATOM records): (download)

>d1qusa_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]}
mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqg
pngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigvetrwgrvm
gktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagamgygqfmps
sykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapglpngfktk
ysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhsthyamavw
qlgqavalarvq

SCOPe Domain Coordinates for d1qusa_:

Click to download the PDB-style file with coordinates for d1qusa_.
(The format of our PDB-style files is described here.)

Timeline for d1qusa_: