SCOPe 2.07: Domain d6gjqd1: 6gjq D:6-121

Lineage for d6gjqd1 (6gjq D:6-121)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
Domain d6gjqd1: 6gjq D:6-121 [369908]
Other proteins in same PDB: d6gjqa_, d6gjqb2, d6gjqd2, d6gjqe_, d6gjqf2, d6gjqg_, d6gjqh2
automated match to d4nbzb_
complexed with atp

Details for d6gjqd1

PDB Entry: 6gjq (more details), 2.49 Å

PDB Description: human nbd1 of cftr in complex with nanobody t27

PDB Compounds: (D:) Nanobody T27

SCOPe Domain Sequences for d6gjqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gjqd1 b.1.1.0 (D:6-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
esgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnyadfveg
rftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvss

SCOPe Domain Coordinates for d6gjqd1:

Click to download the PDB-style file with coordinates for d6gjqd1.
(The format of our PDB-style files is described here.)

Timeline for d6gjqd1: