Lineage for d6gjqg_ (6gjq G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870138Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2870139Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
    Uniprot P13569 389-671
  8. 2870174Domain d6gjqg_: 6gjq G: [369906]
    Other proteins in same PDB: d6gjqb1, d6gjqb2, d6gjqd1, d6gjqd2, d6gjqf1, d6gjqf2, d6gjqh1, d6gjqh2
    automated match to d2pzga_
    complexed with atp

Details for d6gjqg_

PDB Entry: 6gjq (more details), 2.49 Å

PDB Description: human nbd1 of cftr in complex with nanobody t27
PDB Compounds: (G:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d6gjqg_:

Sequence, based on SEQRES records: (download)

>d6gjqg_ c.37.1.12 (G:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
dinfkiergqllavagstgagktsllmmimgelepsegkikhsgrisfcpqfswimpgti
keniifgvsydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislarav
ykdadlylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililheg
ssyfygtfselqnlq

Sequence, based on observed residues (ATOM records): (download)

>d6gjqg_ c.37.1.12 (G:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
dinfkiergqllavagstgagktsllmmimgelepsrisfcpqfswimpgtikeniifgv
sydeyryrsvikacqleediskfpekdntvlgeggitlsggqrarislaravykdadlyl
ldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfygtf
selqnlq

SCOPe Domain Coordinates for d6gjqg_:

Click to download the PDB-style file with coordinates for d6gjqg_.
(The format of our PDB-style files is described here.)

Timeline for d6gjqg_: