Lineage for d1sly_2 (1sly 451-618)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76893Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 proteins)
  6. 76904Protein 70 kDa soluble lytic transglycosylase, SLT70 [53992] (1 species)
  7. 76905Species Escherichia coli [TaxId:562] [53993] (3 PDB entries)
  8. 76908Domain d1sly_2: 1sly 451-618 [36990]
    Other proteins in same PDB: d1sly_1

Details for d1sly_2

PDB Entry: 1sly (more details), 2.8 Å

PDB Description: complex of the 70-kda soluble lytic transglycosylase with bulgecin a

SCOP Domain Sequences for d1sly_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sly_2 d.2.1.6 (451-618) 70 kDa soluble lytic transglycosylase, SLT70 {Escherichia coli}
layndlfkrytsgkeipqsyamaiarqesawnpkvkspvgasglmqimpgtathtvkmfs
ipgysspgqlldpetninigtsylqyvyqqfgnnrifssaaynaglgrvrtwlgnsagri
davafvesipfsetrgyvknvlaydayyryfmgdkptlmsatewgrry

SCOP Domain Coordinates for d1sly_2:

Click to download the PDB-style file with coordinates for d1sly_2.
(The format of our PDB-style files is described here.)

Timeline for d1sly_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sly_1