Lineage for d6gkul1 (6gku L:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759403Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2759416Domain d6gkul1: 6gku L:1-111 [369891]
    Other proteins in same PDB: d6gkua_, d6gkuh_, d6gkul2
    automated match to d2mcg11
    complexed with ca, pge

Details for d6gkul1

PDB Entry: 6gku (more details), 1.91 Å

PDB Description: structure of galectin-10 in complex with the fab fragment of a charcot-leyden crystal solubilizing antibody, 6f5
PDB Compounds: (L:) Fab 6F5 - Light chain

SCOPe Domain Sequences for d6gkul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gkul1 b.1.1.0 (L:1-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
qagltqppsvsgtlgkavtiscagtssdigygnyvswyqqlpgtapklliykvsrrasgv
pdrfsgsksgntaslsisglqsedeadyycasyryrnnvvfgggthltvlg

SCOPe Domain Coordinates for d6gkul1:

Click to download the PDB-style file with coordinates for d6gkul1.
(The format of our PDB-style files is described here.)

Timeline for d6gkul1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gkul2