SCOP 1.73: Domain d1qtea2: 1qte A:451-618

Lineage for d1qtea2 (1qte A:451-618)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 proteins)
   the large N-terminal domain is all-alpha superhelix

6. Protein 70 kDa soluble lytic transglycosylase, SLT70 [53992] (1 species)

7. Species Escherichia coli [TaxId:562] [53993] (3 PDB entries)

8. Domain d1qtea2: 1qte A:451-618 [36989]
   Other proteins in same PDB: d1qtea1
   complexed with act, ah0, gol, nag, so4

Details for d1qtea2

PDB Entry: 1qte, 1.9 Å

PDB Description: crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.90 a resolution in complex with a 1,6- anhydromurotripeptide

PDB Compounds: (A:) soluble lytic transglycosylase slt70

SCOP Domain Sequences for d1qtea2:

Sequence; same for both SEQRES and ATOM records:

>d1qtea2 d.2.1.6 (A:451-618) 70 kDa soluble lytic transglycosylase, SLT70 {Escherichia coli [TaxId: 562]}
layndlfkrytsgkeipqsyamaiarqesawnpkvkspvgasglmqimpgtathtvkmfs
ipgysspgqlldpetninigtsylqyvyqqfgnnrifssaaynagpgrvrtwlgnsagri
davafvesipfsetrgyvknvlaydayyryfmgdkptlmsatewgrry

Timeline for d1qtea2:

• d1qtea2 first appeared (with stable ids) in SCOP 1.55
  
• d1qtea2 appears in SCOP 1.71
  
• d1qtea2 appears in SCOP 1.75
  
• d1qtea2 appears in the current release, SCOPe 2.08