Lineage for d1qtea2 (1qte A:451-618)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76893Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 proteins)
  6. 76904Protein 70 kDa soluble lytic transglycosylase, SLT70 [53992] (1 species)
  7. 76905Species Escherichia coli [TaxId:562] [53993] (3 PDB entries)
  8. 76907Domain d1qtea2: 1qte A:451-618 [36989]
    Other proteins in same PDB: d1qtea1

Details for d1qtea2

PDB Entry: 1qte (more details), 1.9 Å

PDB Description: crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.90 a resolution in complex with a 1,6- anhydromurotripeptide

SCOP Domain Sequences for d1qtea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtea2 d.2.1.6 (A:451-618) 70 kDa soluble lytic transglycosylase, SLT70 {Escherichia coli}
layndlfkrytsgkeipqsyamaiarqesawnpkvkspvgasglmqimpgtathtvkmfs
ipgysspgqlldpetninigtsylqyvyqqfgnnrifssaaynagpgrvrtwlgnsagri
davafvesipfsetrgyvknvlaydayyryfmgdkptlmsatewgrry

SCOP Domain Coordinates for d1qtea2:

Click to download the PDB-style file with coordinates for d1qtea2.
(The format of our PDB-style files is described here.)

Timeline for d1qtea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qtea1