Lineage for d6gjqb1 (6gjq B:6-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369702Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2369742Domain d6gjqb1: 6gjq B:6-121 [369889]
    Other proteins in same PDB: d6gjqa_, d6gjqb2, d6gjqd2, d6gjqe_, d6gjqf2, d6gjqg_, d6gjqh2
    automated match to d4nbzb_
    complexed with atp

Details for d6gjqb1

PDB Entry: 6gjq (more details), 2.49 Å

PDB Description: human nbd1 of cftr in complex with nanobody t27
PDB Compounds: (B:) Nanobody T27

SCOPe Domain Sequences for d6gjqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gjqb1 b.1.1.0 (B:6-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
esgggleqpggslrlscatsgvifginamgwyrqapgkqrelvatftsggstnyadfveg
rftisrdnakntvylqmnglrpedtavyychatvvvsrygltydywgqgtqvtvss

SCOPe Domain Coordinates for d6gjqb1:

Click to download the PDB-style file with coordinates for d6gjqb1.
(The format of our PDB-style files is described here.)

Timeline for d6gjqb1: