Lineage for d6gkob_ (6gko B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972665Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)
  8. 2972690Domain d6gkob_: 6gko B: [369886]
    automated match to d4eb4a_
    complexed with dms, fgt, ump

Details for d6gkob_

PDB Entry: 6gko (more details), 1.84 Å

PDB Description: mouse thymidylate synthase cocrystallized with dump and soaked in phenolphthalein
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d6gkob_:

Sequence, based on SEQRES records: (download)

>d6gkob_ d.117.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaeyk
dmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvnge
lscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplki
qlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav

Sequence, based on observed residues (ATOM records): (download)

>d6gkob_ d.117.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaeyk
dmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvnge
lscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplki
qlqreprpfpklkilrkvetiddfkvedfqiegynphptimemav

SCOPe Domain Coordinates for d6gkob_:

Click to download the PDB-style file with coordinates for d6gkob_.
(The format of our PDB-style files is described here.)

Timeline for d6gkob_: