Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.6: Bacterial muramidase, catalytic domain [53991] (2 proteins) the large N-terminal domain is all-alpha superhelix |
Protein 70 kDa soluble lytic transglycosylase, SLT70 [53992] (1 species) |
Species Escherichia coli [TaxId:562] [53993] (3 PDB entries) |
Domain d1qsaa2: 1qsa A:451-618 [36988] Other proteins in same PDB: d1qsaa1 complexed with act, gol, so4 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1qsa (more details), 1.65 Å
SCOPe Domain Sequences for d1qsaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsaa2 d.2.1.6 (A:451-618) 70 kDa soluble lytic transglycosylase, SLT70 {Escherichia coli [TaxId: 562]} layndlfkrytsgkeipqsyamaiarqesawnpkvkspvgasglmqimpgtathtvkmfs ipgysspgqlldpetninigtsylqyvyqqfgnnrifssaaynagpgrvrtwlgnsagri davafvesipfsetrgyvknvlaydayyryfmgdkptlmsatewgrry
Timeline for d1qsaa2: