Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein automated matches [190029] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries) |
Domain d6gktd_: 6gkt D: [369868] automated match to d1g86a_ complexed with p6g, pg4, pge |
PDB Entry: 6gkt (more details), 2.1 Å
SCOPe Domain Sequences for d6gktd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gktd_ b.29.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr vvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav kmvqvwrdisltkfnvsylk
Timeline for d6gktd_: