Lineage for d6gktd_ (6gkt D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373886Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2374079Protein automated matches [190029] (5 species)
    not a true protein
  7. 2374087Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)
  8. 3069806Domain d6gktd_: 6gkt D: [369868]
    automated match to d1g86a_
    complexed with p6g, pg4, pge

Details for d6gktd_

PDB Entry: 6gkt (more details), 2.1 Å

PDB Description: x-ray structure of a non-autocrystallizing galectin-10 variant, gal10- tyr69glu
PDB Compounds: (D:) Galectin-10

SCOPe Domain Sequences for d6gktd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gktd_ b.29.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sllpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreegawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylk

SCOPe Domain Coordinates for d6gktd_:

Click to download the PDB-style file with coordinates for d6gktd_.
(The format of our PDB-style files is described here.)

Timeline for d6gktd_:

  • d6gktd_ is new in SCOPe 2.07-stable