Lineage for d1gbsa_ (1gbs A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1888793Family d.2.1.5: G-type lysozyme [53987] (2 proteins)
  6. 1888794Protein Lysozyme [53988] (2 species)
  7. 1888795Species Australian black swan (Cygnus atratus) [TaxId:8868] [53990] (2 PDB entries)
  8. 1888796Domain d1gbsa_: 1gbs A: [36986]

Details for d1gbsa_

PDB Entry: 1gbs (more details), 1.5 Å

PDB Description: crystal structure of black swan goose-type lysozyme at 1.8 angstroms resolution
PDB Compounds: (A:) australian black swan egg white lysozyme

SCOPe Domain Sequences for d1gbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbsa_ d.2.1.5 (A:) Lysozyme {Australian black swan (Cygnus atratus) [TaxId: 8868]}
rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
kqhgy

SCOPe Domain Coordinates for d1gbsa_:

Click to download the PDB-style file with coordinates for d1gbsa_.
(The format of our PDB-style files is described here.)

Timeline for d1gbsa_: