Lineage for d6fxqa_ (6fxq A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2557030Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2557031Protein automated matches [190081] (31 species)
    not a true protein
  7. 2557176Species Listeria monocytogenes [TaxId:169963] [272416] (3 PDB entries)
  8. 2557177Domain d6fxqa_: 6fxq A: [369859]
    automated match to d5loqd_
    complexed with fec, mpd, na, vov

Details for d6fxqa_

PDB Entry: 6fxq (more details), 1.69 Å

PDB Description: structure of coproheme decarboxylase from listeria monocytogenes during turnover
PDB Compounds: (A:) Putative heme-dependent peroxidase lmo2113

SCOPe Domain Sequences for d6fxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fxqa_ d.58.4.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}
avktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiysi
lgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmaggdd
pyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyag
kvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllse
qlsklfti

SCOPe Domain Coordinates for d6fxqa_:

Click to download the PDB-style file with coordinates for d6fxqa_.
(The format of our PDB-style files is described here.)

Timeline for d6fxqa_: