Lineage for d6f94a_ (6f94 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580554Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2580555Protein automated matches [226867] (21 species)
    not a true protein
  7. 2580615Species Escherichia coli [TaxId:83334] [333464] (11 PDB entries)
  8. 2580623Domain d6f94a_: 6f94 A: [369857]
    automated match to d5mmoa_
    protein/DNA complex; complexed with d0h

Details for d6f94a_

PDB Entry: 6f94 (more details), 2.35 Å

PDB Description: crystal structure of e. coli gyraseb 24kda in complex with 6- [(ethylcarbamoyl)amino]-4-[(3-methyphenyl)amino]-n-(3-methyphenyl) pyridine-3-carboxamide
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6f94a_:

Sequence, based on SEQRES records: (download)

>d6f94a_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelvi
qregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrel
sflnsgvsirlrdkrdgkedhfhye

Sequence, based on observed residues (ATOM records): (download)

>d6f94a_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgihpeegvsaaevimtvlgvgvsvvnalsqklelviqregkihrqiyehgvpqa
plavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsirlrdkrdgk
edhfhye

SCOPe Domain Coordinates for d6f94a_:

Click to download the PDB-style file with coordinates for d6f94a_.
(The format of our PDB-style files is described here.)

Timeline for d6f94a_: