![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
![]() | Protein automated matches [190081] (33 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:169963] [272416] (3 PDB entries) |
![]() | Domain d6fxja_: 6fxj A: [369856] automated match to d1vdha_ complexed with cl, fec, na, pol |
PDB Entry: 6fxj (more details), 1.79 Å
SCOPe Domain Sequences for d6fxja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fxja_ d.58.4.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]} mneavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehti ysilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmag gddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrs yagkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignll lseqlsklfti
Timeline for d6fxja_:
![]() Domains from other chains: (mouse over for more information) d6fxjb_, d6fxjc_, d6fxjd_, d6fxje_ |