Lineage for d6fxjc_ (6fxj C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950304Species Listeria monocytogenes [TaxId:169963] [272416] (3 PDB entries)
  8. 2950312Domain d6fxjc_: 6fxj C: [369846]
    automated match to d1vdha_
    complexed with cl, fec, na, pol

Details for d6fxjc_

PDB Entry: 6fxj (more details), 1.79 Å

PDB Description: structure of coproheme decarboxylase from listeria monocytogenes in complex with iron coproporphyrin iii
PDB Compounds: (C:) Putative heme-dependent peroxidase lmo2113

SCOPe Domain Sequences for d6fxjc_:

Sequence, based on SEQRES records: (download)

>d6fxjc_ d.58.4.0 (C:) automated matches {Listeria monocytogenes [TaxId: 169963]}
eavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiys
ilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmaggd
dpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsya
gkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignllls
eqlsklfti

Sequence, based on observed residues (ATOM records): (download)

>d6fxjc_ d.58.4.0 (C:) automated matches {Listeria monocytogenes [TaxId: 169963]}
eavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiys
ilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnyqnkgvrarl
ypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagkvqqiiggsig
fddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseqlsklfti

SCOPe Domain Coordinates for d6fxjc_:

Click to download the PDB-style file with coordinates for d6fxjc_.
(The format of our PDB-style files is described here.)

Timeline for d6fxjc_: