Lineage for d6f8ja_ (6f8j A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974056Species Escherichia coli [TaxId:83334] [333464] (11 PDB entries)
  8. 2974060Domain d6f8ja_: 6f8j A: [369841]
    automated match to d5mmoa_
    protein/DNA complex; complexed with cz5

Details for d6f8ja_

PDB Entry: 6f8j (more details), 1.95 Å

PDB Description: crystal structure of e. coli gyraseb 24kda in complex with 6- [(ethylcarbamoyl)amino]-4-(1h-pyrazol-1-yl)-n-(pyridin-3-yl)pyridine- 3-carboxamide
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6f8ja_:

Sequence, based on SEQRES records: (download)

>d6f8ja_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelvi
qregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrel
sflnsgvsirlrdkrdgkedhfhye

Sequence, based on observed residues (ATOM records): (download)

>d6f8ja_ d.122.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgihpeegvsaaevimtvlgvgvsvvnalsqklelviqregkihrqiyehgvpqa
plavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsirlrdkrdgk
edhfhye

SCOPe Domain Coordinates for d6f8ja_:

Click to download the PDB-style file with coordinates for d6f8ja_.
(The format of our PDB-style files is described here.)

Timeline for d6f8ja_: