Lineage for d1am7c_ (1am7 C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. Family d.2.1.4: Lambda lysozyme [53984] (1 protein)
  6. Protein Lambda lysozyme [53985] (1 species)
  7. Species Bacteriophage lambda [TaxId:10710] [53986] (3 PDB entries)
  8. Domain d1am7c_: 1am7 C: [36983]
    complexed with ipa

Details for d1am7c_

PDB Entry: 1am7 (more details), 2.3 Å

PDB Description: Lysozyme from bacteriophage lambda
PDB Compounds: (C:) lysozyme

SCOPe Domain Sequences for d1am7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1am7c_ d.2.1.4 (C:) Lambda lysozyme {Bacteriophage lambda [TaxId: 10710]}
mveinnqrkafldmlawsegtdngrqktrnhgydvivggelftdysdhprklvtlnpklk
stgagryqllsrwwdayrkqlglkdfspksqdavalqqikergalpmidrgdirqaidrc
sniwaslpgagygqfehkadsliakfkeaggtvr

SCOPe Domain Coordinates for d1am7c_ are not available.

Timeline for d1am7c_:

Domains from other chains:
(mouse over for more information)
d1am7a_, d1am7b_