Lineage for d6f6ta_ (6f6t A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730943Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2730944Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2731115Family a.127.1.2: HAL/PAL-like [48572] (3 proteins)
    Pfam PF00221
  6. 2731146Protein automated matches [349210] (2 species)
    not a true protein
  7. 2731147Species Parsley (Petroselinum crispum) [TaxId:4043] [369828] (4 PDB entries)
  8. 2731152Domain d6f6ta_: 6f6t A: [369829]
    automated match to d1w27a_
    complexed with cv2, mdo

Details for d6f6ta_

PDB Entry: 6f6t (more details), 1.9 Å

PDB Description: phenylalanine ammonia-lyase (pal) from petroselinum crispum complexed with s-appa
PDB Compounds: (A:) phenylalanine ammonia-lyase 1

SCOPe Domain Sequences for d6f6ta_:

Sequence, based on SEQRES records: (download)

>d6f6ta_ a.127.1.2 (A:) automated matches {Parsley (Petroselinum crispum) [TaxId: 4043]}
edplywgiaaeamtgshldevkkmvaeyrkpvvklggetltisqvaaisardgsgvtvel
seaaragvkassdwvmdsmnkgtdsygvttgfgatshrrtkqggalqkelirflnagifg
ngsdntlphsatraamlvrintllqgysgirfeileaitkflnqnitpclplrgtitasg
dlvplsyiaglltgrpnskavgptgvilspeeafklagveggffelqpkeglalvngtav
gsgmasmvlfeanilavlaevmsaifaevmqgkpeftdhlthklkhhpgqieaaaimehi
ldgsayvkaaqklhemdplqkpkqdryalrtspqwlgpqievirsstkmiereinsvndn
plidvsrnkaihggnfqgtpigvsmdntrlaiaaigklmfaqfselvndfynnglpsnls
ggrnpsldygfkgaeiamasycselqflanpvtnhvqsaeqhnqdvnslglissrktsea
veilklmsttflvglcqaidlrhleenlkstvkntvssvakrvltmgvngelhpsrfcek
dllrvvdreyifayiddpcsatyplmqklrqtlvehalkngdnernlstsifqkiatfed
elkallpkevesaraalesgnpaipnrieecrsyplykfvrkelgteyltgekvtspgee
fekvfiamskgeiidpllesleswngaplpis

Sequence, based on observed residues (ATOM records): (download)

>d6f6ta_ a.127.1.2 (A:) automated matches {Parsley (Petroselinum crispum) [TaxId: 4043]}
edplywgiaaeamtgshldevkkmvaeyrkpvvklggetltisqvaaisardgsgvtvel
seaaragvkassdwvmdsmnkgtdsygvttgfgatshrrtkqggalqkelirflnagifg
ngsdntlphsatraamlvrintllqgysgirfeileaitkflnqnitpclplrgtitasg
dlvplsyiaglltgrpnskavgptgvilspeeafklagveggffelqpkeglalvngtav
gsgmasmvlfeanilavlaevmsaifaevmqgkpeftdhlthklkhhpgqieaaaimehi
ldgsayvkaaqklpkqdryalrtspqwlgpqievirsstkmiereinsvndnplidvsrn
kaihggnfqgtpigvsmdntrlaiaaigklmfaqfselvndfynnglpsnlsggrnpsld
ygfkgaeiamasycselqflanpvtnhvqsaeqhnqdvnslglissrktseaveilklms
ttflvglcqaidlrhleenlkstvkntvssvakrvlthpsrfcekdllrvvdreyifayi
ddpcsatyplmqklrqtlvehalkngdnernlstsifqkiatfedelkallpkevesara
alesgnpaipnrieecrsyplykfvrkelgteyltgekvtspgeefekvfiamskgeiid
pllesleswngaplpis

SCOPe Domain Coordinates for d6f6ta_:

Click to download the PDB-style file with coordinates for d6f6ta_.
(The format of our PDB-style files is described here.)

Timeline for d6f6ta_: